DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and GstD8

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster


Alignment Length:180 Identity:41/180 - (22%)
Similarity:74/180 - (41%) Gaps:41/180 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 VLDAKKIPYHAIYINLRDKPEWFSLVSSSTKVPALELVKEQGNPVLIESLIICDYLDEKY-PEVP 102
            |:|.:::           |||:..| :....:|.|   .:.|..:. ||..|..||.||| .:..
  Fly    33 VMDGEQL-----------KPEFVKL-NPQHCIPTL---VDDGFSIW-ESRAILIYLVEKYGADDS 81

  Fly   103 LYPKDLLKKA--QEKILIER---FGQFINAFYYLLLHDNPE-----QLVDTDHYAGLVVYEEELK 157
            |||.|..|||  .:::..:.   |..|:.|.|..:.:::|.     |.||: .:..|..:.|:  
  Fly    82 LYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQIRNNHPADPEAMQKVDS-AFGHLDTFLED-- 143

  Fly   158 RRCTKFFGGDSPGMLDYMMWPWCERFDSLKYTFEQKFELSPERFPTLIKW 207
               .::..||...:.|..:......|:.:.:...|        :|.:.:|
  Fly   144 ---QEYVAGDCLTIADIALLASVSTFEVVDFDIAQ--------YPNVARW 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 13/55 (24%)
GstA 22..216 CDD:223698 41/180 (23%)
GST_C_Omega 109..234 CDD:198293 20/109 (18%)
GstD8NP_524916.1 GstA 1..188 CDD:223698 41/180 (23%)
GST_N_Delta_Epsilon 1..74 CDD:239343 14/56 (25%)
GST_C_Delta_Epsilon 88..204 CDD:198287 20/109 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460142
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.