DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and GstD4

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster


Alignment Length:162 Identity:43/162 - (26%)
Similarity:69/162 - (42%) Gaps:30/162 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 KPEWFSLVSSSTKVPALELVKEQGNPVLIESLIICDYLDEKY-PEVPLYPKDLLKKA--QEKILI 118
            |||:..|....| :|.|   .:.|..:. ||..|..||.||| .:..|:|.|..|:|  .:::..
  Fly    40 KPEFLKLNPQHT-IPTL---VDNGFAIW-ESRAIAVYLVEKYGKDDSLFPNDPQKRALINQRLYF 99

  Fly   119 ERFGQFINAF---YYLLLHDNPEQLVDTDHYAGLVVYEEELKRRCTKFFGGDSPGMLDYMMWPWC 180
            : .|...::|   ||..:...  ||.:.::|..:....|.|    ..|..|.     ||:.....
  Fly   100 D-MGTLHDSFMKYYYPFIRTG--QLGNAENYKKVEAAFEFL----DIFLEGQ-----DYVAGSQL 152

  Fly   181 ERFD----SLKYTFE-QKFELSPERFPTLIKW 207
            ...|    |...||| .:|::|  ::|.:.:|
  Fly   153 TVADIAILSSVSTFEVVEFDIS--KYPNVARW 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 12/37 (32%)
GstA 22..216 CDD:223698 43/162 (27%)
GST_C_Omega 109..234 CDD:198293 24/109 (22%)
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 43/162 (27%)
GST_N_Delta_Epsilon 1..74 CDD:239343 13/38 (34%)
GST_C_Delta_Epsilon 88..204 CDD:198287 24/109 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460145
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.