DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and gsto2

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001005086.1 Gene:gsto2 / 448662 XenbaseID:XB-GENE-967227 Length:241 Species:Xenopus tropicalis


Alignment Length:220 Identity:93/220 - (42%)
Similarity:125/220 - (56%) Gaps:12/220 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LTIGSPKPVFPDDGILKLYSMRFCPYAHRVHLVLDAKKIPYHAIYINLRDKPEWFSLVSSSTKVP 71
            |..|||.|....:..:::|||||||||.|..|||.||.|.:..|.|||::||:||...|....||
 Frog     8 LAKGSPAPGPVSEETIRVYSMRFCPYAQRARLVLAAKGIKHEVININLKNKPDWFIEKSPFGLVP 72

  Fly    72 ALELVKEQGNPVLIESLIICDYLDEKYPEVPLYPKDLLKKAQEKILIERFGQFINAFYYLLL-HD 135
            :||....|   |:.||.|:||||||.||...|.|.|..:|||:|:::|.|.:....||.:|| ..
 Frog    73 SLETSSGQ---VIYESPIVCDYLDEVYPGKKLTPVDPFQKAQQKMIVEHFSKISTLFYKILLAKK 134

  Fly   136 NPEQL--VDTDHYAGLVVYEEELKRRCTKFFGGDSPGMLDYMMWPWCERFDSLKYTFEQKFELSP 198
            |.|.:  |..:....||..:|.|.::...||||....|:|||:|||.||.    ..|:.|..|: 
 Frog   135 NNEDVSGVKAEVQEKLVKLDEILAKQNGLFFGGSDVSMVDYMIWPWFERL----IIFDSKDCLN- 194

  Fly   199 ERFPTLIKWRDLMIQDRAVKCFYLD 223
             :.|.:.||...|:||.|||..|::
 Frog   195 -KTPHIDKWYQQMLQDPAVKATYIE 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 42/87 (48%)
GstA 22..216 CDD:223698 84/196 (43%)
GST_C_Omega 109..234 CDD:198293 43/118 (36%)
gsto2NP_001005086.1 GST_N_Omega 4..93 CDD:239353 42/87 (48%)
GST_C_Omega 107..229 CDD:198293 43/118 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I8115
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 164 1.000 Inparanoid score I4074
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 1 1.000 - - FOG0001358
OrthoInspector 1 1.000 - - mtm9331
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.