DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and eEF1gamma

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster


Alignment Length:208 Identity:41/208 - (19%)
Similarity:74/208 - (35%) Gaps:45/208 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 KVPALELVKEQGNPVLIESLIICDYLDEKYPEVPLYPKDLLKKAQEKILIERFGQFIN------- 126
            ||||.|..:.|             ||.|......|...:.|:..:...:..:..|:|:       
  Fly    54 KVPAFETAEGQ-------------YLSESNAIAYLLANEQLRGGKCPFVQAQVQQWISFADNEIV 105

  Fly   127 ----AFYYLLLHDNPEQLVDT-DHYAGLVVYEEELKRRCTKFFGGDSPGMLDYMMWPWCERFDSL 186
                |:.:.||...|:|...| ...|..|:.:...|.:...|..|:...:.|.::      |.||
  Fly   106 PASCAWVFPLLGILPQQKNSTAKQEAEAVLQQLNQKLQDATFLAGERITLADIVV------FSSL 164

  Fly   187 KYTFEQKFELS-PERFPTLIKWRDLMIQDRAV-----------KCFYLDGQTHAKYMNSRRSGQA 239
            .:.:|...|.| ...|..:.:|...::..:.|           |....|.:.:|::  ..::|.|
  Fly   165 LHLYEYVLEPSVRSAFGNVNRWFVTILNQKQVQAVVKDYKLCEKALVFDPKKYAEF--QAKTGAA 227

  Fly   240 DYNMLYNEAKRVK 252
            .......:.|:.|
  Fly   228 KPQQQAQQQKQEK 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 7/25 (28%)
GstA 22..216 CDD:223698 33/159 (21%)
GST_C_Omega 109..234 CDD:198293 27/148 (18%)
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 10/37 (27%)
GstA 5..187 CDD:223698 32/151 (21%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 23/124 (19%)
EF1G 271..376 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459934
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.