DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and GstD9

DIOPT Version :10

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_650181.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster


Alignment Length:168 Identity:37/168 - (22%)
Similarity:69/168 - (41%) Gaps:36/168 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 KPEWFSLVSSSTKVPALELVKEQGNPVLIESLIICDYLDEKY-PEVPLYPKDLLKKAQEKILIER 120
            ||| |..::....:|.|   .:.|..:. ||..|..||.||| .:..|||||    .|::.:|.:
  Fly    41 KPE-FVKINPQHTIPTL---VDDGFAIW-ESRAILIYLAEKYDKDGSLYPKD----PQQRAVINQ 96

  Fly   121 ---------FGQFINAFYYLLLHD-----NPEQLVDTDHYAGLVVYEEELKRRCTKFFGGDSPGM 171
                     :..::..:|..|..|     :|:.|...|.  ...::...||.:  ::...:...:
  Fly    97 RLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDNLKKIDD--AFAMFNTLLKGQ--QYAALNKLTL 157

  Fly   172 LDYMMWPWCERFDSLKYTFEQKFELSPERFPTLIKWRD 209
            .|:.:......|:..:|.|        .::|.:::|.|
  Fly   158 ADFALLATVSTFEISEYDF--------GKYPEVVRWYD 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 3..95 CDD:469754 11/37 (30%)
GST_C_Omega 109..234 CDD:198293 17/115 (15%)
GstD9NP_650181.1 GstA 1..187 CDD:440390 36/166 (22%)

Return to query results.
Submit another query.