DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and GstD9

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster


Alignment Length:168 Identity:37/168 - (22%)
Similarity:69/168 - (41%) Gaps:36/168 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 KPEWFSLVSSSTKVPALELVKEQGNPVLIESLIICDYLDEKY-PEVPLYPKDLLKKAQEKILIER 120
            ||| |..::....:|.|   .:.|..:. ||..|..||.||| .:..|||||    .|::.:|.:
  Fly    41 KPE-FVKINPQHTIPTL---VDDGFAIW-ESRAILIYLAEKYDKDGSLYPKD----PQQRAVINQ 96

  Fly   121 ---------FGQFINAFYYLLLHD-----NPEQLVDTDHYAGLVVYEEELKRRCTKFFGGDSPGM 171
                     :..::..:|..|..|     :|:.|...|.  ...::...||.:  ::...:...:
  Fly    97 RLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDNLKKIDD--AFAMFNTLLKGQ--QYAALNKLTL 157

  Fly   172 LDYMMWPWCERFDSLKYTFEQKFELSPERFPTLIKWRD 209
            .|:.:......|:..:|.|        .::|.:::|.|
  Fly   158 ADFALLATVSTFEISEYDF--------GKYPEVVRWYD 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 11/37 (30%)
GstA 22..216 CDD:223698 37/168 (22%)
GST_C_Omega 109..234 CDD:198293 17/115 (15%)
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 12/38 (32%)
GstA 4..187 CDD:223698 36/166 (22%)
GST_C_Delta_Epsilon 89..207 CDD:198287 17/111 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460144
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.