DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and clic5b

DIOPT Version :10

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_998062.1 Gene:clic5b / 405833 ZFINID:ZDB-GENE-040426-2542 Length:408 Species:Danio rerio


Alignment Length:185 Identity:39/185 - (21%)
Similarity:68/185 - (36%) Gaps:62/185 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CPYAHRVHLVLDAKKIPYHAIYINLRDKPEWFSLVSSSTKVPALEL---VKEQGNPVLIESLIIC 91
            ||::.|:.::|..|.:.::...::|:.||.....::..|..|.|..   ||...|.:        
Zfish   190 CPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGEVKTDVNKI-------- 246

  Fly    92 DYLDEKYPEV---PLYPK-------------DLLKK--------------AQEKIL---IERFGQ 123
               :|...||   |.|||             |:..|              |.||.|   :::..:
Zfish   247 ---EEFLEEVLAPPKYPKLAARHRESNAAGNDIFAKFSAFIKNTKPDANEALEKGLTKALKKLDE 308

  Fly   124 FINAFYYLLLHDNPEQLVDTDHYAGLVVYEEELKRRCTKFFGGDSPGMLDYMMWP 178
            ::|:       ..|:: ||.|..       ||.|....:|..|:...:.|..:.|
Zfish   309 YLNS-------PLPDE-VDADSM-------EEEKASNRRFLDGNDLTLADCNLLP 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 3..95 CDD:469754 14/67 (21%)
GST_C_Omega 109..234 CDD:198293 17/87 (20%)
clic5bNP_998062.1 EFh_CREC <53..150 CDD:330175
EF-hand motif 81..119 CDD:320021
EF-hand motif 126..150 CDD:320021
O-ClC 172..407 CDD:129941 39/185 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.