DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and GstE12

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster


Alignment Length:95 Identity:32/95 - (33%)
Similarity:42/95 - (44%) Gaps:11/95 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LYSMRFCPYAHRVHLVLDAKKIPYHAIYINLRD----KPEWFSLVSSSTKVPALELVKEQGNPVL 84
            ||.....|.:..|.|...|..:......|||..    .||:..|....| :|.|    ..|...:
  Fly     6 LYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHT-IPTL----IDGEATI 65

  Fly    85 IESLIICDYLDEKY--PEVPLYPKDLLKKA 112
            |:|..||.||.|||  .|..||||:|:::|
  Fly    66 IDSHAICAYLVEKYGQKEQQLYPKELVQRA 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 21/74 (28%)
GstA 22..216 CDD:223698 32/95 (34%)
GST_C_Omega 109..234 CDD:198293 1/4 (25%)
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 22/75 (29%)
GstA 6..201 CDD:223698 32/95 (34%)
GST_C_Delta_Epsilon 92..210 CDD:198287 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460196
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.