DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and GstE11

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster


Alignment Length:232 Identity:51/232 - (21%)
Similarity:84/232 - (36%) Gaps:78/232 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SPKPVFPDDGILKLYSMRFCPYAHRVHLVLDAKKIPYHAIYINLR---DKPEWFSLVSSSTKVPA 72
            |.||:        ||.....|....|.|...|..:......:|::   .|...|..:::...:|.
  Fly     2 SAKPI--------LYYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPV 58

  Fly    73 LELVKEQGNPVLIESLIICDYLDEKY-PE--VPLYPKDLLKKAQEKILIERFGQFINA-FYYLLL 133
            |    :....::.:|.|||.||.:|| ||  ..|||||..|:           :.::| .||...
  Fly    59 L----DDNGTIVSDSHIICSYLADKYAPEGDDSLYPKDPEKR-----------RLVDARLYYDCG 108

  Fly   134 HDNP--EQLVDTDHYAGLVVYEEELKRRCTKFFGGDSPG-MLDYMMWPWCERFDSLKY------- 188
            |..|  ..:|:.      |:|          |..|:.|. .:.|:.    :.:|.|::       
  Fly   109 HLFPRIRFIVEP------VIY----------FGAGEVPSDRVAYLQ----KAYDGLEHCLAEGDY 153

  Fly   189 ------------------TFEQKFELSPERFPTLIKW 207
                              |.|....:.|::||.|::|
  Fly   154 LVGDKLTIADLSCIASVSTAEAFAPIEPDQFPRLVQW 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 19/86 (22%)
GstA 22..216 CDD:223698 48/221 (22%)
GST_C_Omega 109..234 CDD:198293 22/128 (17%)
GstE11NP_001286575.1 GstA 5..198 CDD:223698 49/229 (21%)
GST_N_Delta_Epsilon 5..78 CDD:239343 18/84 (21%)
GST_C_Delta_Epsilon 94..211 CDD:198287 22/128 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460197
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.