DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and GstE8

DIOPT Version :10

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_611330.2 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster


Alignment Length:217 Identity:53/217 - (24%)
Similarity:83/217 - (38%) Gaps:38/217 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LKLYSMRFCPYAHRVHLVLDAKKIPYHAIYINLRDK----PEWFSLVSSSTKVPALELVKEQGNP 82
            |.||.....|......|.|.|..|||..:.||...|    ||:.......| ||.||   :.|: 
  Fly     4 LILYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHT-VPTLE---DDGH- 63

  Fly    83 VLIESLIICDYLDEKYPEV-PLYPKDLLKKA--QEKILIERFGQFINAFYYLL--LHDNPEQLVD 142
            .:.:|..|..||..||.:. .|||||||::|  .:::..|....|:|....:.  |....:..:.
  Fly    64 FIWDSHAISAYLVSKYGQSDTLYPKDLLQRAVVDQRLHFESGVVFVNGLRGITKPLFATGQTTIP 128

  Fly   143 TDHYAGLVVYEEELKRRCT--KFFGGDSPGMLDYMM---------------------WPWCERFD 184
            .:.|..::...:.::...|  .|..||...:.|:.:                     ..|.:|.:
  Fly   129 KERYDAVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITALAVFVVIDTVKYANITAWIKRIE 193

  Fly   185 SLKYTFEQKFELSPERFPTLIK 206
            .|.| :|:..........||:|
  Fly   194 ELPY-YEEACGKGARDLVTLLK 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 3..95 CDD:469754 24/76 (32%)
GST_C_Omega 109..234 CDD:198293 20/125 (16%)
GstE8NP_611330.2 GstA 4..209 CDD:440390 50/210 (24%)

Return to query results.
Submit another query.