DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and GstE7

DIOPT Version :10

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster


Alignment Length:179 Identity:49/179 - (27%)
Similarity:73/179 - (40%) Gaps:43/179 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LKLYSMRFCPYAHRVHLVLDAKKIPYHAIYINLRDK---PEWFSLVSSSTKVPALELVKEQGNPV 83
            |.||.:...|....|.|.|.|.::||..:.:|.|.|   .|.|...:....||.||   :.|: .
  Fly     4 LILYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLE---DDGH-Y 64

  Fly    84 LIESLIICDYLDEKYPEV-PLYPKDLLKKAQEKILIERFGQFINAFYYLLLHDNPEQLVDTDHYA 147
            :.:|..|..||..||.:. .|||||||::|   ::.:|.                       |:.
  Fly    65 IWDSHAIIAYLVSKYGKTDSLYPKDLLQRA---VVDQRL-----------------------HFE 103

  Fly   148 GLVVYEEELKRRCTKFFGGDSPGMLDYMMWPWCERFDSL--KYTFEQKF 194
            ..|::...|:......|.|..      .|.| .||:|::  .|.|.:||
  Fly   104 SGVIFANALRSITKPLFAGKQ------TMIP-KERYDAIIEVYDFLEKF 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 3..95 CDD:469754 23/75 (31%)
GST_C_Omega 109..234 CDD:198293 17/88 (19%)
GstE7NP_611329.1 GST_N_Delta_Epsilon 4..77 CDD:239343 24/76 (32%)
GST_C_Delta_Epsilon 91..209 CDD:198287 17/88 (19%)

Return to query results.
Submit another query.