Sequence 1: | NP_648237.1 | Gene: | GstO1 / 38975 | FlyBaseID: | FBgn0035907 | Length: | 254 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_611328.1 | Gene: | GstE6 / 37111 | FlyBaseID: | FBgn0063494 | Length: | 222 | Species: | Drosophila melanogaster |
Alignment Length: | 210 | Identity: | 52/210 - (24%) |
---|---|---|---|
Similarity: | 77/210 - (36%) | Gaps: | 59/210 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 LKLYSMRFCPYAHRVHLVLDAKKIPYHAIYINL------RDKPEWFSLVSSSTKVPALELVKEQG 80
Fly 81 NPVLIESLIICDYLDEKYPEV-PLYPKDLLKKA-----------------------------QEK 115
Fly 116 ILIERFGQFINAFYYLLLHDNPEQ-LVDTDHYAG--LVVYEEELKRRCTKFFGGDSPGMLDYMMW 177
Fly 178 P----WCERFDSLKY 188 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstO1 | NP_648237.1 | Thioredoxin_like | 3..95 | CDD:294274 | 22/78 (28%) |
GstA | 22..216 | CDD:223698 | 52/210 (25%) | ||
GST_C_Omega | 109..234 | CDD:198293 | 22/116 (19%) | ||
GstE6 | NP_611328.1 | GstA | 4..196 | CDD:223698 | 50/207 (24%) |
GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 23/79 (29%) | ||
GST_C_Delta_Epsilon | 91..209 | CDD:198287 | 22/116 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45460195 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |