DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and GstE5

DIOPT Version :10

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster


Alignment Length:227 Identity:54/227 - (23%)
Similarity:86/227 - (37%) Gaps:58/227 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LKLYSMRFCPYAHRVHLVLDAKKIPYHAIYIN-----------LRDKPEWFSLVSSSTKVPALEL 75
            |.||.:...|....|.|.|.|.::||..:.:|           |:..||        ..||.|| 
  Fly     4 LTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPE--------HTVPTLE- 59

  Fly    76 VKEQGNPVLIESLIICDYLDEKYPEV-PLYPKDLLKKA--QEKILIERFGQFINA-------FYY 130
              :.|| .:.:|..|..||..||.:. .|||:|||::|  .:::..|....|.|.       .::
  Fly    60 --DDGN-YIWDSHAIIAYLVSKYADSDALYPRDLLQRAVVDQRLHFETGVVFANGIKAITKPLFF 121

  Fly   131 LLLHDNPEQLVDT---------------DHYAG--LVVYEEELKRRCTKFFGGDSPGMLDYMMWP 178
            ..|:..|::..|.               |:.||  |.:.:..|....|.......   :|.:.:|
  Fly   122 NGLNRIPKERYDAIVEIYDFVETFLAGHDYIAGDQLTIADFSLISSITSLVAFVE---IDRLKYP 183

  Fly   179 ----WCERFDSLKYTFEQKFELSPERFPTLIK 206
                |..|.:.|.| :|:..........|::|
  Fly   184 RIIEWVRRLEKLPY-YEEANAKGARELETILK 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 3..95 CDD:469754 23/83 (28%)
GST_C_Omega 109..234 CDD:198293 23/128 (18%)
GstE5NP_611327.1 GstA 4..210 CDD:440390 52/221 (24%)

Return to query results.
Submit another query.