DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and GstE4

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster


Alignment Length:259 Identity:59/259 - (22%)
Similarity:98/259 - (37%) Gaps:87/259 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GILKLYSMRFCPYAHRVHLVLDAKKIPYHAIYINLRDK---PEWFSLVSSSTKVPALELVKEQGN 81
            |.:.||.:...|......|.|.|..:|:..:::||.:|   .|.||..:....||.|    :..:
  Fly     2 GKISLYGLDASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLL----QDDD 62

  Fly    82 PVLIESLIICDYLDEKY-PEVPLYPKDLLKKAQEKILIERFGQFINAFYYLLLHDNPEQLVDTDH 145
            ..:.:|..|..||.||| |...|||||||::|:                       .:||:   |
  Fly    63 ACIWDSHAIMAYLVEKYAPSDELYPKDLLQRAK-----------------------VDQLM---H 101

  Fly   146 YAGLVVYEEELKR--RCTKFFGGDS--PGMLDYMMWPWCERFDSLKYTFEQKF------------ 194
            :...|::|..|:|  |...|||..:  ...:|:::         ..|.|.:.|            
  Fly   102 FESGVIFESALRRLTRPVLFFGEPTLPRNQVDHIL---------QVYDFVETFLDDHDFVAGDQL 157

  Fly   195 ------------------ELSPERFPTLIKW----RDLMIQDRAVKCFYLDGQTHAKYMNSRRS 236
                              ||.|.::|.:..|    ::|...:.|      :|:..|:::...||
  Fly   158 TIADFSIVSTITSIGVFLELDPAKYPKIAAWLERLKELPYYEEA------NGKGAAQFVELLRS 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 20/77 (26%)
GstA 22..216 CDD:223698 53/235 (23%)
GST_C_Omega 109..234 CDD:198293 26/162 (16%)
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 20/76 (26%)
GstA 6..196 CDD:223698 52/228 (23%)
GST_C_Delta_Epsilon 91..209 CDD:198287 26/158 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460187
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.