DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and GstE10

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster


Alignment Length:138 Identity:42/138 - (30%)
Similarity:57/138 - (41%) Gaps:16/138 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LKLYSMRFCPYAHRVHLVLDAKKI--PYHAIYINLRD--KPEWFSLVSSSTKVPALELVKEQGNP 82
            |.||.....|....|.|.|.|.::  .:|.:.:...|  ||:........| ||.|    |.|..
  Fly     4 LILYGTESSPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHT-VPML----EDGES 63

  Fly    83 VLIESLIICDYLDEKYPEV-PLYPKDLLKKA--QEKILIERFGQFINAFYYL---LLHDNPEQLV 141
            .:.:|..|..||..||.:. .|||||.||:|  .:::..|....|...|..|   |..:|..: |
  Fly    64 CIWDSHAIIGYLVNKYAQSDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQLQRALFKENATE-V 127

  Fly   142 DTDHYAGL 149
            ..|..|.|
  Fly   128 PKDRLAEL 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 21/76 (28%)
GstA 22..216 CDD:223698 42/138 (30%)
GST_C_Omega 109..234 CDD:198293 13/46 (28%)
GstE10NP_001286570.1 GstA 4..197 CDD:223698 42/138 (30%)
GST_N_Delta_Epsilon 4..77 CDD:239343 22/77 (29%)
GST_C_Delta_Epsilon 91..211 CDD:198287 13/46 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460185
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.