DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and GstE13

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster


Alignment Length:244 Identity:48/244 - (19%)
Similarity:80/244 - (32%) Gaps:80/244 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LYSMRFCPYAHRVHLVLDAKKIPYHAIYINLRDKP----------EWFSLVSSSTKVPALELVKE 78
            ||...|.|.|....||  ||     .|.::|..||          |.|..::...::|.  .|..
  Fly     6 LYYALFSPPARACILV--AK-----LIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPV--FVDS 61

  Fly    79 QGNPVLIESLIICDYLDEKYP-EVPLYPKDLLKKAQEKILIERFGQFINAFYYLLLHD------- 135
            .|...:....|:| :|..||. ...|||:||.::|.    |:....:.|...:.::.|       
  Fly    62 DGEVYVDSHAIVC-FLVAKYAGNDQLYPRDLKRRAH----IDHRMHYENGVLFQVVKDIVARNIY 121

  Fly   136 ------NPEQLV-------DTDHYAGLVVYEEELKRRCTKFFGGDSPGMLDYMMWPWCERFDSLK 187
                  ||..|.       |.:|:.           :...|..|:...:.|..:       .:..
  Fly   122 GGEGEYNPRSLTLCHNAYSDLEHFL-----------QQGSFVVGNELSVADVSI-------HTTL 168

  Fly   188 YTFEQKFELSPERFPTLIKWRDLM-----------------IQDRAVKC 219
            .|.:....:..|::|...:|.:.|                 :|.|.:.|
  Fly   169 VTLDLLIPVEREKYPQTKQWMERMDKLLPDNEEINLKGARALQTRILSC 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 20/80 (25%)
GstA 22..216 CDD:223698 46/239 (19%)
GST_C_Omega 109..234 CDD:198293 20/148 (14%)
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 21/81 (26%)
GST_C_Delta_Epsilon 92..211 CDD:198287 17/140 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460191
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.