DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and gsto-2

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_871705.3 Gene:gsto-2 / 353420 WormBaseID:WBGene00015337 Length:254 Species:Caenorhabditis elegans


Alignment Length:228 Identity:73/228 - (32%)
Similarity:112/228 - (49%) Gaps:42/228 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NTQHLTIGSPKPVFPDDGILKLYSMRFCPYAHRVHLVLDAKKIPYHAIYINLRDKPEWFSLVSSS 67
            ||:.:..|.|.|..|..|.:::|:||:||:|.|..:....||||...|.|:|..||:||......
 Worm     8 NTKVVKNGDPAPAPPASGTIRIYNMRYCPWAQRALIFASLKKIPTEVINIHLDQKPDWFFTKHYK 72

  Fly    68 TKVPALELVKEQGNPVLIESLIICDYLDEKYPEVPLYPKDLLKKAQEKILIERF-GQFINAFYYL 131
            .:|||||  .::|..::|||.:|.:|||:.|||..:.|.|..:|.|:|:|::|. ||..:|||.:
 Worm    73 GQVPALE--HDEGKKIVIESAVIPEYLDDIYPEPRIIPTDHYEKVQQKLLLDRISGQLSSAFYGV 135

  Fly   132 L------------------LHDNPEQLVDTDHYAGLVVYEEELKRRCTKFFGGDSPGMLDYMMWP 178
            :                  .:|..|:|:..|.|:|.                 ..||.:||:::|
 Worm   136 VQAAKISDLLKEKLVELAKAYDTAEELLTGDFYSGT-----------------SKPGFVDYLIYP 183

  Fly   179 WCER---FDSLKYTFEQKFELSP-ERFPTLIKW 207
            ..:|   ...:...|..|.|..| ..:|.|.||
 Worm   184 NIQRAFWTSHIIKDFPLKVESFPGPNYPKLSKW 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 36/91 (40%)
GstA 22..216 CDD:223698 66/209 (32%)
GST_C_Omega 109..234 CDD:198293 30/122 (25%)
gsto-2NP_871705.3 Thioredoxin_like 8..98 CDD:294274 36/91 (40%)
GstA 29..224 CDD:223698 66/207 (32%)
GST_C_family 112..242 CDD:295467 30/122 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159283
Domainoid 1 1.000 74 1.000 Domainoid score I5948
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37971
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.71939 Normalized mean entropy S4834
OMA 1 1.010 - - QHG48297
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 1 1.000 - - FOG0001358
OrthoInspector 1 1.000 - - mtm4834
orthoMCL 1 0.900 - - OOG6_100366
Panther 1 1.100 - - O PTHR43968
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X130
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.670

Return to query results.
Submit another query.