DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and GstT4

DIOPT Version :10

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster


Alignment Length:177 Identity:38/177 - (21%)
Similarity:64/177 - (36%) Gaps:59/177 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LKLYSMRFCPYAHRVHLVLDAKKIPYHAIYINL----------RDKPEWFSLVSSSTKVPALELV 76
            ||.|.......:..::::|:|.|||:.||.|::          ||.      |:...|:||   :
  Fly     5 LKFYFDFLNQSSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDN------VNRFRKLPA---I 60

  Fly    77 KEQGNPVLIESLIICDYL-DEKYPEVPLYPKDLLKKA---------------------QEKILI- 118
            .:.|.. |.|::.|..:| .||......||:..|.::                     |:|.|: 
  Fly    61 TDHGYQ-LSENVAIFRHLAREKLVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQQKWLVP 124

  Fly   119 ----------------ERFGQFINAFYYLLLHDNPEQLVDTDHYAGL 149
                            ::....:|.|..|.|:.....:.|...||.|
  Fly   125 YLQKTRPADNAVNLASKQLEHTLNEFEQLFLNSRKFMMGDNISYADL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 3..95 CDD:469754 22/83 (27%)
GST_C_Omega 109..234 CDD:198293 12/79 (15%)
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 22/84 (26%)
GST_C_Theta 95..220 CDD:198292 11/77 (14%)

Return to query results.
Submit another query.