DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and Gsto2

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001012071.1 Gene:Gsto2 / 309465 RGDID:1310764 Length:248 Species:Rattus norvegicus


Alignment Length:248 Identity:88/248 - (35%)
Similarity:128/248 - (51%) Gaps:44/248 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TQHLTIGS--PKPVFPDDGILKLYSMRFCPYAHRVHLVLDAKKIPYHAIYINLRDKPEWFSLVSS 66
            |:.|..||  |.||  .:|::::||||||||:||..|||.||.|.:..|.|||::||:|:.....
  Rat     6 TRCLGKGSCPPGPV--PEGVIRIYSMRFCPYSHRTRLVLKAKSIRHEIININLKNKPDWYYTKHP 68

  Fly    67 STKVPALELVKEQGNPVLIESLIICDYLDEKYPEVPLYPKDLLKKAQEKILIERFGQFINAFYYL 131
            ..:||.||..:.|   ::.||:|.|:|||:.:|...|:|.|..::|::|:|:|.|.:....    
  Rat    69 FGQVPVLENSQCQ---LIYESVIACEYLDDVFPGRKLFPYDPYERARQKMLLELFCKVPQL---- 126

  Fly   132 LLHDNPEQLVD-------TDHYAG----LVVYEEELKRRCTKFFGGDSPGMLDYMMWPWCERF-- 183
                :.|.||.       ||....    |...||.|:.:.|.||||||..|:||::|||.||.  
  Rat   127 ----SKECLVALRCGRDCTDLKVALRQELCNLEEILEYQNTTFFGGDSISMIDYLVWPWFERLDV 187

  Fly   184 ----DSLKYTFEQKFELSPERFPTLIKWRDLMIQDRAVKCFYLDGQTHAKYMN 232
                |.:.:|            |.|..|...|.||.||...::|......::|
  Rat   188 YGLADCVNHT------------PMLRLWISSMKQDPAVCALHIDKNIFLGFLN 228

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 41/92 (45%)
GstA 22..216 CDD:223698 76/210 (36%)
GST_C_Omega 109..234 CDD:198293 41/141 (29%)
Gsto2NP_001012071.1 GST_N_Omega 7..94 CDD:239353 40/91 (44%)