DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and Gstt1

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_445745.1 Gene:Gstt1 / 25260 RGDID:2765 Length:240 Species:Rattus norvegicus


Alignment Length:99 Identity:31/99 - (31%)
Similarity:47/99 - (47%) Gaps:12/99 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ILKLYSMRFCPYAHRVHLVLDAKKIPYHAIYINLRDKPEW----FSLVSSSTKVPALELVKEQGN 81
            :|:||..........:::......||:....:.|| |.|.    |:.|:...||||:    :.|.
  Rat     2 VLELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELR-KGEHLSDAFAQVNPMKKVPAM----KDGG 61

  Fly    82 PVLIESLIICDYLDEKYPEVP--LYPKDLLKKAQ 113
            ..|.||:.|..||..|| :||  .||:||..:|:
  Rat    62 FTLCESVAILLYLAHKY-KVPDHWYPQDLQARAR 94

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 21/77 (27%)
GstA 22..216 CDD:223698 31/98 (32%)
GST_C_Omega 109..234 CDD:198293 1/5 (20%)
Gstt1NP_445745.1 GST_N_Theta 3..78 CDD:239348 22/79 (28%)