DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and GstE9

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster


Alignment Length:218 Identity:55/218 - (25%)
Similarity:82/218 - (37%) Gaps:53/218 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GILKLYSMRFCPYAHRVHLVLDAKKIPYHAIYINL---RDKPEWFSLVSSSTKVPALELVKEQGN 81
            |.|.||.:...|......|.|||..:.|....:||   ..|.:.|||.:....||.||   :.|.
  Fly     2 GKLVLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLE---DDGK 63

  Fly    82 PVLIESLIICDYLDEKYPEV-PLYPKDLLKKAQEKILIERFGQFINA-------------FYYLL 132
             .:.||..||.||..:|.:. .|||||..|:|    |:::...|.:.             .:|..
  Fly    64 -FIWESHAICAYLVRRYAKSDDLYPKDYFKRA----LVDQRLHFESGVLFQGCIRNIAIPLFYKN 123

  Fly   133 LHDNPEQLVDTDHYAGLVVYE--EELKRRCTKFFGGDSPGMLDYMMWPWCERFDSLKYTFEQKFE 195
            :.:.|...:|       .:||  :.|:    .|.|..:     |:..|.....|   |:......
  Fly   124 ITEVPRSQID-------AIYEAYDFLE----AFIGNQA-----YLCGPVITIAD---YSVVSSVS 169

  Fly   196 -------LSPERFPTLIKWRDLM 211
                   :..:|:|.|..|.|.|
  Fly   170 SLVGLAAIDAKRYPKLNGWLDRM 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 26/77 (34%)
GstA 22..216 CDD:223698 54/216 (25%)
GST_C_Omega 109..234 CDD:198293 22/125 (18%)
GstE9NP_725784.1 GstA 4..201 CDD:223698 54/216 (25%)
GST_N_Delta_Epsilon 4..76 CDD:239343 25/75 (33%)
GST_C_Delta_Epsilon 92..209 CDD:198287 22/124 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460189
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.71939 Normalized mean entropy S4834
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.790

Return to query results.
Submit another query.