DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and Gstt2

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_011241675.1 Gene:Gstt2 / 14872 MGIID:106188 Length:251 Species:Mus musculus


Alignment Length:246 Identity:58/246 - (23%)
Similarity:87/246 - (35%) Gaps:53/246 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VHLVLDAKKIPYHAIYINLRDK-----------------PEWFSLVSSSTKVPALE---LVKEQG 80
            :.|.||....|..|:||..:..                 .|.||.|:...|||.|:   .|..:.
Mouse     3 LELYLDLLSQPSRAVYIFAKKNGIPFQTRTVDILKGQHMSEQFSQVNCLNKVPVLKDGSFVLTES 67

  Fly    81 NPVLIESLIICDYLDEKYPEVP-LYPKDLLKKAQEKILIERFGQFINAFYYLLLHDN-------- 136
            ...:|.|..|..||..||.... .||.||..:||....:......|...:.:||...        
Mouse    68 PSSMIPSTAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLLWTKVLGPLIGV 132

  Fly   137 --PEQLVDTDHYAGLVVYE--EELKRRCTKFFGGDSPGMLDYMMWPWCERFDSLKYT-FEQKFEL 196
              |::.|:.:....::|.:  |:...|...|..|....:.|.|......:..:|.|. ||.:   
Mouse   133 QVPQEKVERNRDRMVLVLQQLEDKFLRDRAFLVGQQVTLADLMSLEELMQPVALGYNLFEGR--- 194

  Fly   197 SPERFPTLIKWRDLMIQDRAVKCFY---LDGQTHAKYMNSRRSGQADYNML 244
                 |.|..||:      .|:.|.   |..:.|:..::.  .|||...||
Mouse   195 -----PQLTAWRE------RVEAFLGAELCQEAHSTILSI--LGQAAKKML 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 20/78 (26%)
GstA 22..216 CDD:223698 49/213 (23%)
GST_C_Omega 109..234 CDD:198293 26/140 (19%)
Gstt2XP_011241675.1 GST_N_Theta 3..85 CDD:239348 21/81 (26%)
GST_C_Theta 98..223 CDD:198292 26/138 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844521
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.