DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and sspA

DIOPT Version :10

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_417696.1 Gene:sspA / 944744 ECOCYCID:EG10977 Length:212 Species:Escherichia coli


Alignment Length:162 Identity:45/162 - (27%)
Similarity:76/162 - (46%) Gaps:13/162 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 FSHRVRLMLAAKHIEHHKIYVDLIEKPEWYKDFSPLGKVPALQLTGVKDQPTLVESLIIAEYLDQ 97
            :||:||::||.|.:.....:|:....|:...|.:|...||.|    |..:.||.||.||.||||:
E. coli    21 YSHQVRIVLAEKGVSFEIEHVEKDNPPQDLIDLNPNQSVPTL----VDRELTLWESRIIMEYLDE 81

  Fly    98 QYPQTRLFPTDPLQKALDKILIER----FAPVVSAIYPVLTCNPNAPKDAIPNFENALDVFEVEL 158
            ::|...|.|..|:.:...::.:.|    :..:::.|........:|.:..:.  |..|.:..| .
E. coli    82 RFPHPPLMPVYPVARGESRLYMHRIEKDWYTLMNTIINGSASEADAARKQLR--EELLAIAPV-F 143

  Fly   159 GKRGTPYFAGQHIGIVDYMIWPWFERFPSMKI 190
            |::  |||......:||..:.|...|.|.:.|
E. coli   144 GQK--PYFLSDEFSLVDCYLAPLLWRLPQLGI 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 5..96 CDD:469754 23/62 (37%)
GST_C_Omega 110..235 CDD:198293 16/85 (19%)
sspANP_417696.1 sspA 1..211 CDD:236537 45/162 (28%)

Return to query results.
Submit another query.