DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and Clic5

DIOPT Version :10

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_446055.1 Gene:Clic5 / 94272 RGDID:620659 Length:251 Species:Rattus norvegicus


Alignment Length:76 Identity:22/76 - (28%)
Similarity:35/76 - (46%) Gaps:1/76 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SMAFCPFSHRVRLMLAAKHIEHHKIYVDLIEKPEWYKDFSPLGKVPALQLTG-VKDQPTLVESLI 90
            |:..||||.|:.::|..|.:..:...|||..||....:.:|....|.|...| ||.....:|..:
  Rat    28 SIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFL 92

  Fly    91 IAEYLDQQYPQ 101
            ......::||:
  Rat    93 EETLTPEKYPK 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 5..96 CDD:469754 20/69 (29%)
GST_C_Omega 110..235 CDD:198293
Clic5NP_446055.1 Required for insertion into the membrane. /evidence=ECO:0000250 1..98 20/69 (29%)
O-ClC 14..249 CDD:129941 22/76 (29%)
G-site. /evidence=ECO:0000250|UniProtKB:O00299 32..35 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.