DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and CAM1

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_015277.1 Gene:CAM1 / 856059 SGDID:S000005969 Length:415 Species:Saccharomyces cerevisiae


Alignment Length:209 Identity:47/209 - (22%)
Similarity:81/209 - (38%) Gaps:33/209 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RVRLMLAAKHIEHHKIYVDLI----EKPEWYKDFSPLGKVPALQLTGVKDQPTLVESLIIAEYL- 95
            |:|..:....::..|:.|.::    ...::.:|| ||.||||  ..|.|.. .|.|::.|..|| 
Yeast    11 RIRTWVPRGLVKALKLDVKVVTPDAAAEQFARDF-PLKKVPA--FVGPKGY-KLTEAMAINYYLV 71

  Fly    96 ----DQQYPQTRLFPTDPLQKALDKILIERFA------PVVSAIYPV---LTCNPNAPKDAIPNF 147
                |.:.....|...|.|......|..:..|      .:.:.|.|:   ...|..:...|:...
Yeast    72 KLSQDDKMKTQLLGADDDLNAQAQIIRWQSLANSDLCIQIANTIVPLKGGAPYNKKSVDSAMDAV 136

  Fly   148 ENALDVFEVELGKRGTPYFAGQHIGIVDYMIWPWFERFPSMKINTEQKYE-------LDTKRFEK 205
            :..:|:||..|  :...|.|.::|.:.|.:....|.|:......||.:.:       .:|.|...
Yeast   137 DKIVDIFENRL--KNYTYLATENISLADLVAASIFTRYFESLFGTEWRAQHPAIVRWFNTVRASP 199

  Fly   206 LLK--WRDLMTQDE 217
            .||  ::|....|:
Yeast   200 FLKDEYKDFKFADK 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 19/68 (28%)
GstA 25..215 CDD:223698 46/205 (22%)
GST_C_Omega 110..235 CDD:198293 25/126 (20%)
CAM1NP_015277.1 GST_N_EF1Bgamma 4..73 CDD:239342 19/65 (29%)
GST_C_EF1Bgamma_like 92..214 CDD:198290 24/124 (19%)
EF1G 255..359 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345041
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.