DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and TEF4

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_012842.1 Gene:TEF4 / 853781 SGDID:S000001564 Length:412 Species:Saccharomyces cerevisiae


Alignment Length:235 Identity:53/235 - (22%)
Similarity:93/235 - (39%) Gaps:63/235 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IEHHKIYVDLI--EKPEWYKDFSPLGKVPA-LQLTGVKDQPTLVESLIIAEYLDQQY----PQTR 103
            |.:.|:.|.::  |:...:....||.:.|| |...|:|    |.|:|.|..||..|.    .:.|
Yeast    21 ISYFKLDVKIVDLEQSSEFASLFPLKQAPAFLGPKGLK----LTEALAIQFYLANQVADEKERAR 81

  Fly   104 LFPTDPLQKALDKILIERFAPVVSA------IYPVLTCN---PNAPKDAIPNF---ENALDVFEV 156
            |..:|.::|:  :||  |:|.:.::      ..|.|:..   |...||....|   :|...||:.
Yeast    82 LLGSDVIEKS--QIL--RWASLANSDVMSNIARPFLSFKGLIPYNKKDVDACFVKIDNLAAVFDA 142

  Fly   157 ELGKRGTPYFAGQHIGIVDY------------MIWP-WFERFPSMKINTEQKYELDTKRFEKLLK 208
            .|  |...:.|.::|.:.|.            ::.| |..:.|                  .|::
Yeast   143 RL--RDYTFVATENISLGDLHAAGSWAFGLATILGPEWRAKHP------------------HLMR 187

  Fly   209 WRDLMTQDEVVQKTALDVQLHAEFQKSKTLGNPQYDIAFK 248
            |.:.:....:|:....:|:|   .:|:.|...|:...|.|
Yeast   188 WFNTVAASPIVKTPFAEVKL---AEKALTYTPPKKQKAEK 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 16/52 (31%)
GstA 25..215 CDD:223698 45/200 (23%)
GST_C_Omega 110..235 CDD:198293 27/149 (18%)
TEF4NP_012842.1 GST_N_EF1Bgamma 4..72 CDD:239342 17/54 (31%)
GST_C_EF1Bgamma_like 89..211 CDD:198290 27/148 (18%)
EF1G 253..356 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345045
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.