DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and YGR201C

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_011717.4 Gene:YGR201C / 853115 SGDID:S000003433 Length:225 Species:Saccharomyces cerevisiae


Alignment Length:185 Identity:39/185 - (21%)
Similarity:68/185 - (36%) Gaps:43/185 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 DLIEKPEWYKDFSPLGKVPALQLTGVKDQPTLVESLIIAEYL-----DQQYPQTRLFPTDPLQKA 113
            |..:..:.|:...||.|.|.  ..|..|:.||.|::.|..||     |::..:..|.|....:..
Yeast    36 DPSDAQQLYEREFPLRKYPT--FVGPHDEWTLTEAMAIDYYLIHLSSDKEAVRQLLGPEGDFKTR 98

  Fly   114 LDKILIERFA------PVVSAIYPVLTCNP-NAP--KDAIPNFENALDVFEVELGKRGTPYF--- 166
            .|.:..|..:      .|....:|::...| ||.  |.|..|.:..:.::|..|.|:  .|.   
Yeast    99 ADILRWESLSNSDFLNEVCEVFFPLIGVKPYNATEFKAARENVDTIVSLYEKRLKKQ--QYLVCD 161

  Fly   167 -----------AGQHIGIVDYMIWPWFERFPSMKINTEQKYELDTKRFEKLLKWR 210
                       |...:|.:.:....|..:.|.:           |:.|.:::|.|
Yeast   162 DHETLADLISAAAFSLGFISFFDETWRSKHPEV-----------TRWFNRVIKSR 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 14/46 (30%)
GstA 25..215 CDD:223698 39/185 (21%)
GST_C_Omega 110..235 CDD:198293 22/124 (18%)
YGR201CNP_011717.4 Thioredoxin_like 4..78 CDD:412351 14/43 (33%)
GST_C_EF1Bgamma_like 98..220 CDD:198290 22/121 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345037
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.