DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and GTT2

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_013040.1 Gene:GTT2 / 850666 SGDID:S000003983 Length:233 Species:Saccharomyces cerevisiae


Alignment Length:222 Identity:53/222 - (23%)
Similarity:83/222 - (37%) Gaps:57/222 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PFSHRVRLMLAAKHI--------------EHHKIYVDLIEKPEWY-KDFSPLGKVPALQLTGVKD 81
            |:..|||:.||.|::              ||        :|||:. |::|  |.||.|:|    |
Yeast    28 PYPARVRIALAEKNMLSSVQFVRINLWKGEH--------KKPEFLAKNYS--GTVPVLEL----D 78

  Fly    82 QPTLV-ESLIIAEYLDQQYPQTRLFPTDPLQKALDKILIERFAPVVSAIYPVLTCNPNAPKDAIP 145
            ..||: |...|.||:|.......|....||:|.:..::.:|  ..:..:.||.....:|.....|
Yeast    79 DGTLIAECTAITEYIDALDGTPTLTGKTPLEKGVIHMMNKR--AELELLDPVSVYFHHATPGLGP 141

  Fly   146 NFE----------------NALDVFEVELGKRGTPYFAGQHIGIVDYMIWPWFERFPSMKINTEQ 194
            ..|                :.:..|:..|.:|  ||.||....:.|..:.........:|:...:
Yeast   142 EVELYQNKEWGLRQRDKALHGMHYFDTVLRER--PYVAGDSFSMADITVIAGLIFAAIVKLQVPE 204

  Fly   195 KYELDTKRFEKLLKWRDLMTQDEVVQK 221
            :       .|.|..|...|.|...|:|
Yeast   205 E-------CEALRAWYKRMQQRPSVKK 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 26/79 (33%)
GstA 25..215 CDD:223698 50/214 (23%)
GST_C_Omega 110..235 CDD:198293 24/128 (19%)
GTT2NP_013040.1 GST_N_GTT2_like 19..94 CDD:239349 26/79 (33%)
GST_C_GTT2_like 106..222 CDD:198291 23/126 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345130
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16830
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.