DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and GSTU23

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_177955.1 Gene:GSTU23 / 844167 AraportID:AT1G78320 Length:220 Species:Arabidopsis thaliana


Alignment Length:209 Identity:53/209 - (25%)
Similarity:85/209 - (40%) Gaps:38/209 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 FSHRVRLMLAAKHIEHHKIYVDLIEKPEWYKDFSPL-GKVPALQLTGVKDQPTLVESLIIAEYLD 96
            :..|.|:.|..|.:::.....||..|.......:|: .|:|.|    :.:...:.||:|..:|:|
plant    15 YGMRTRIALEEKKVKYEYREEDLSNKSPLLLQMNPIHKKIPVL----IHEGKPICESIIQVQYID 75

  Fly    97 QQYPQTR-LFPTDPLQKA--------LDKILIERFAPVVSAIYPVLTCNPNAPKDAIPNFENALD 152
            :.:|.|. :.|:||.|:|        :||   :.:.| ..|::........|.|   ..|...|.
plant    76 ELWPDTNPILPSDPYQRAQARFWADYIDK---KTYVP-CKALWSESGEKQEAAK---IEFIEVLK 133

  Fly   153 VFEVELGKRGTPYFAGQHIGIVDYM---IWPWF---ERFPSMKINTEQKYELDTKRFEKLLKWRD 211
            ..:.|||.:  .||.|...|:||..   .:.||   |...::.|..|         |.||:.|..
plant   134 TLDSELGDK--YYFGGNEFGLVDIAFIGFYSWFRTYEEVANLSIVLE---------FPKLMAWAQ 187

  Fly   212 LMTQDEVVQKTALD 225
            ...:.|.|.|...|
plant   188 RCLKRESVAKALPD 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 15/63 (24%)
GstA 25..215 CDD:223698 49/197 (25%)
GST_C_Omega 110..235 CDD:198293 32/130 (25%)
GSTU23NP_177955.1 GST_N_Tau 5..78 CDD:239356 16/66 (24%)
GST_C_Tau 89..211 CDD:198294 33/131 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.