DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and GSTU10

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_177598.1 Gene:GSTU10 / 843799 AraportID:AT1G74590 Length:232 Species:Arabidopsis thaliana


Alignment Length:204 Identity:44/204 - (21%)
Similarity:78/204 - (38%) Gaps:44/204 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 FSHRVRLMLAAKHIEHHKIYVDLIEKPEWYKDFSPL-GKVPALQLTGVKDQPTLVESLIIAEYLD 96
            :|.||.:.|..|.:.:..:..||..|.|.....:|: .|:|.|    |.|...:.|||:|.||:|
plant    18 YSKRVEIALKLKGVLYEYLEEDLQNKSESLIQLNPVHKKIPVL----VHDGKPVAESLVILEYID 78

  Fly    97 QQYPQT-RLFPTDPLQKALDKILIERF-APVVSAIYPVLTCNPNAPKDAIPNFENALDVFEVELG 159
            :.:..: |.||.||.::|..:..:... ..|...:..|::....|...::........|.:..|.
plant    79 ETWTNSPRFFPEDPYERAQVRFWVSYINQQVFEVMGQVMSQEGEAQAKSVEEARKRFKVLDEGLK 143

  Fly   160 KRGTPYFAGQHI------GIVDYMI---------------------------WPWFERFPSMKIN 191
            |    :|..::|      |:::..|                           :.|.||...:.:.
plant   144 K----HFPNKNIRRNDDVGLLEITIIATLGGYKAHREAIGVDIIGPVNTPTLYNWIERLQDLSVI 204

  Fly   192 TEQKYELDT 200
            .|.:...||
plant   205 KEVEVPHDT 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 21/63 (33%)
GstA 25..215 CDD:223698 44/204 (22%)
GST_C_Omega 110..235 CDD:198293 17/125 (14%)
GSTU10NP_177598.1 GST_N_Tau 8..81 CDD:239356 22/66 (33%)
GST_C_Tau 92..221 CDD:198294 18/126 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.