Sequence 1: | NP_729388.1 | Gene: | GstO2 / 38974 | FlyBaseID: | FBgn0035906 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_177598.1 | Gene: | GSTU10 / 843799 | AraportID: | AT1G74590 | Length: | 232 | Species: | Arabidopsis thaliana |
Alignment Length: | 204 | Identity: | 44/204 - (21%) |
---|---|---|---|
Similarity: | 78/204 - (38%) | Gaps: | 44/204 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 FSHRVRLMLAAKHIEHHKIYVDLIEKPEWYKDFSPL-GKVPALQLTGVKDQPTLVESLIIAEYLD 96
Fly 97 QQYPQT-RLFPTDPLQKALDKILIERF-APVVSAIYPVLTCNPNAPKDAIPNFENALDVFEVELG 159
Fly 160 KRGTPYFAGQHI------GIVDYMI---------------------------WPWFERFPSMKIN 191
Fly 192 TEQKYELDT 200 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstO2 | NP_729388.1 | Thioredoxin_like | 5..96 | CDD:294274 | 21/63 (33%) |
GstA | 25..215 | CDD:223698 | 44/204 (22%) | ||
GST_C_Omega | 110..235 | CDD:198293 | 17/125 (14%) | ||
GSTU10 | NP_177598.1 | GST_N_Tau | 8..81 | CDD:239356 | 22/66 (33%) |
GST_C_Tau | 92..221 | CDD:198294 | 18/126 (14%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0406 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1225872at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 1 | 1.000 | - | - | X130 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.820 |