DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and GSTU11

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_177151.1 Gene:GSTU11 / 843329 AraportID:AT1G69930 Length:234 Species:Arabidopsis thaliana


Alignment Length:227 Identity:53/227 - (23%)
Similarity:93/227 - (40%) Gaps:43/227 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PFSHRVRLMLAAKHIEHHKIYVDLIEKPEWYKDFSPLGK-VPALQLTGVKDQPTLVESLIIAEYL 95
            ||..|.|:.|..|::.:..:..:.....|...:::|:.| :|.|    :.....:.|||.|..|:
plant    22 PFVLRTRIALNLKNVAYEYLEEEDTLSSESVLNYNPVHKQIPIL----IHGNKPIRESLNIVMYV 82

  Fly    96 DQQY---PQTRLFPTDPLQKALDKILIERFAPV------VSAIYPVLTC----NPNAPKDAIPNF 147
            |:.:   |.  :.|:||..:|     :.||..|      .::|..|...    |.||   ||...
plant    83 DETWLSGPP--ILPSDPFDRA-----VARFWDVYIDEHCFTSINGVAVAKGEENINA---AIAKL 137

  Fly   148 ENALDVFEVELGK--RGTPYFAGQHIGIVDY----MIWPW--FERFPSMKINTEQKYELDTKRFE 204
            |..:.:.|....:  :|..:|.|::||.:|.    |:.|.  .|:|..:|.       :..:...
plant   138 EQCMALLEETFQECSKGRGFFGGENIGFIDIGFGSMLGPLTVLEKFTGVKF-------IHPENTP 195

  Fly   205 KLLKWRDLMTQDEVVQKTALDVQLHAEFQKSK 236
            .|..|.|.....|.|:....|::...:|.:.|
plant   196 GLFHWADRFYAHEAVKPVMPDIEKLVQFARLK 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 16/64 (25%)
GstA 25..215 CDD:223698 48/204 (24%)
GST_C_Omega 110..235 CDD:198293 31/142 (22%)
GSTU11NP_177151.1 GST_N_Tau 13..86 CDD:239356 17/67 (25%)
GST_C_Tau 97..225 CDD:198294 32/142 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.