DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and GSTU16

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_176178.1 Gene:GSTU16 / 842261 AraportID:AT1G59700 Length:234 Species:Arabidopsis thaliana


Alignment Length:221 Identity:57/221 - (25%)
Similarity:101/221 - (45%) Gaps:33/221 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FCPFSHRVRLMLAAKHIEHHKIYVDLI-EKPEWYKDFSPL-GKVPALQLTGVKDQPTLVESLIIA 92
            :.|::.|.::.|..|.:::..:..:|. .|.|.....:|: .|||.|    :.:...:||||.|.
plant    14 YSPYAIRPKIALRLKSVDYDYVEENLFGSKSELLLKSNPVHKKVPVL----LHNNKPIVESLNIV 74

  Fly    93 EYLDQQYPQT--RLFPTDPLQKALDK----ILIERFAPVVSAIYPVLTCNPNAPKDAIPNFENAL 151
            ||:|:.:..:  .:.|:.|..:||.:    .:..::.|.:.  ...:|.:.:|...|:...|..|
plant    75 EYIDETWNSSAPSILPSHPYDRALARFWSDFVDNKWFPALR--MAAITKSEDAKAKAMEEVEEGL 137

  Fly   152 ----DVFEVELGKRGTPYFAGQHIGIVDYMIWPWF------ERFPSMKINTEQKYELDTKRFEKL 206
                |.| |.:.| |.|:|.|:.||.:|.....:.      |:|.:.|:       ||..:...|
plant   138 LQLEDAF-VSISK-GKPFFGGEAIGFMDICFGSFVVLLKAREKFKAEKL-------LDESKTPSL 193

  Fly   207 LKWRDLMTQDEVVQKTALDVQLHAEF 232
            .||.|....||.|:..|.:::..|||
plant   194 CKWADRFLSDETVKNVAPEIEKVAEF 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 19/67 (28%)
GstA 25..215 CDD:223698 50/202 (25%)
GST_C_Omega 110..235 CDD:198293 35/137 (26%)
GSTU16NP_176178.1 GST_N_Tau 7..81 CDD:239356 20/70 (29%)
GST_C_Tau 93..223 CDD:198294 36/138 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.