DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and GSTU15

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_176176.1 Gene:GSTU15 / 842257 AraportID:AT1G59670 Length:233 Species:Arabidopsis thaliana


Alignment Length:220 Identity:50/220 - (22%)
Similarity:94/220 - (42%) Gaps:31/220 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FCPFSHRVRLMLAAKHIEHHKIYVDLI-EKPEWYKDFSPL-GKVPALQLTGVKDQPTLVESLIIA 92
            :.|...|.::.|..|.:::..:..||. .|.|.....:|: .|||.|    :.:...:..||.|.
plant    14 YSPVVIRAKIALRLKSVDYDYVEEDLFGSKSELLLKSNPIFKKVPVL----IHNTKPVCVSLNIV 74

  Fly    93 EYLDQQYPQ--TRLFPTDPLQKALDK----ILIERFAPVVSAIYPVLTCNPNAPKDAIPNFENAL 151
            ||:|:.:..  :.:.|:.|..:||.:    .:.:::.|.:.|  .|:..:..|....:...|..|
plant    75 EYIDETWNSSGSSILPSHPYDRALARFWSVFVDDKWLPTLMA--AVVAKSEEAKAKGMEEVEEGL 137

  Fly   152 DVFE---VELGKRGTPYFAGQHIGIVDYMIWPWF------ERFPSMKINTEQKYELDTKRFEKLL 207
            ...|   :.|.| |..:|.|:.||.:|..:..:.      |:..:.||       ||..:...|.
plant   138 LQLEAAFIALSK-GKSFFGGETIGFIDICLGSFLVLLKAREKLKNEKI-------LDELKTPSLY 194

  Fly   208 KWRDLMTQDEVVQKTALDVQLHAEF 232
            :|.:....:|:|:....|:...|:|
plant   195 RWANQFLSNEMVKNVVPDIDKVAKF 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 18/67 (27%)
GstA 25..215 CDD:223698 45/201 (22%)
GST_C_Omega 110..235 CDD:198293 29/136 (21%)
GSTU15NP_176176.1 GST_N_Tau 7..81 CDD:239356 19/70 (27%)
GST_C_Tau 93..223 CDD:198294 30/137 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.