DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and GSTU28

DIOPT Version :10

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_175772.1 Gene:GSTU28 / 841805 AraportID:AT1G53680 Length:224 Species:Arabidopsis thaliana


Alignment Length:192 Identity:47/192 - (24%)
Similarity:79/192 - (41%) Gaps:32/192 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PFSHRVRLMLAAKHIEHHKIYVDLIEKPEWYKDFSPL-GKVPALQLTGVKDQPTLVESLIIAEYL 95
            |::.|.::.|..|.:|......||..|.|.....:|: .|||.|    :.:...:.||||..:|:
plant    17 PYAMRTKVALREKGVEFEVQEEDLWNKSELLLKSNPVHKKVPVL----IHNNTPISESLIQVQYI 77

  Fly    96 DQQYPQTRLF-PTDPLQKALDKILIERFAPVVSAIYPVLTCNPNAPKDAIPN------------F 147
            |:.:.....| |:||..:|..:..         |.|...|.:....:....|            |
plant    78 DETW
TDAASFLPSDPQSRATARFW---------ADYADKTISFEGGRKIWGNKKGEEQEKGKKEF 133

  Fly   148 ENALDVFEVELGKRGTPYFAGQHIGIVDYMIWPWFERFPSMKINTEQKYELDTKRFEKLLKW 209
            ..:|.|.|.|||.:.  ||.|:..|.||..:.|::..|.:::...:...|.:.   .|::.|
plant   134 LESLKVLEAELGDKS--YFGGETFGYVDITLVPFYSWFYALEKCGDFSVEAEC---PKIVAW 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 5..96 CDD:469754 19/64 (30%)
GST_C_Omega 110..235 CDD:198293 23/112 (21%)
GSTU28NP_175772.1 GST_N_Tau 8..81 CDD:239356 20/67 (30%)
GST_C_Tau 92..217 CDD:198294 24/113 (21%)

Return to query results.
Submit another query.