DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and GSTU13

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_174033.1 Gene:GSTU13 / 839602 AraportID:AT1G27130 Length:227 Species:Arabidopsis thaliana


Alignment Length:230 Identity:55/230 - (23%)
Similarity:92/230 - (40%) Gaps:47/230 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PFSHRVRLMLAAKHIEHHKIYVD----LIEKPEWYKDFSPL-GKVPALQLTGVKDQPTLVESLII 91
            |:|.|.|:.|..|.:::.  |:|    |.||.|.....:|: .|||.|    :....::.|||.:
plant    16 PYSLRARVALHLKSVKYE--YLDEPDVLKEKSELLLKSNPIHKKVPVL----LHGDLSISESLNV 74

  Fly    92 AEYLDQQYPQT-RLFPTDPLQKALDKILIER-----FAPVVSAIYPVLTCNPNAPKD------AI 144
            .:|:|:.:|.. .:.|:|...:|..:...:.     ||.|.:.:         ..||      |:
plant    75 VQYVDEAWPSVPSILPSDAYDRASARFWAQYIDDKCFAAVDAVV---------GAKDDEGKMAAV 130

  Fly   145 PNFENALDVFEVELGK--RGTPYFAGQHIGIVDY----MIWP--WFERFPSMKINTEQKYELDTK 201
            ......|.:.|....|  :|..:|.|:.||.:|.    ::.|  ..|.|..:|.       |..:
plant   131 GKLMECLAILEETFQKSSKGLGFFGGETIGYLDIACSALLGPISVIEAFSGVKF-------LRQE 188

  Fly   202 RFEKLLKWRDLMTQDEVVQKTALDVQLHAEFQKSK 236
            ....|:||.:.....|.|:.....|:....|.|.|
plant   189 TTPGLIKWAERFRAHEAVKPYMPTVEEVVAFAKQK 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 21/68 (31%)
GstA 25..215 CDD:223698 49/207 (24%)
GST_C_Omega 110..235 CDD:198293 28/143 (20%)
GSTU13NP_174033.1 GST_N_Tau 7..82 CDD:239356 22/71 (31%)
GstA 8..219 CDD:223698 52/224 (23%)
GST_C_Tau 93..222 CDD:198294 28/144 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.