DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and DHAR1

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_173387.1 Gene:DHAR1 / 838544 AraportID:AT1G19570 Length:213 Species:Arabidopsis thaliana


Alignment Length:200 Identity:55/200 - (27%)
Similarity:83/200 - (41%) Gaps:51/200 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CPFSHRVRLMLAAKHIEHHKIYVDLIEKPEWYKDFSPLGKVPALQLTGVKDQPTLVESLIIAEYL 95
            ||||.|..|.|..|.:.:....::|.:||:|:.|.||.||||.|::    |...:.:|.:|...|
plant    20 CPFSQRALLTLEEKSLTYKIHLINLSDKPQWFLDISPQGKVPVLKI----DDKWVTDSDVIVGIL 80

  Fly    96 DQQYPQTRLFPTDPLQKALDKILIERFAPVVSAIYPVLTCNPNAPKDAIPNFENA----LDVFEV 156
            :::||.      .||:...:      ||.|.|.|:........: ||:....|:|    |:..|.
plant    81 EEKYPD------PPLKTPAE------FASVGSNIFGTFGTFLKS-KDSNDGSEHALLVELEALEN 132

  Fly   157 ELGKRGTPYFAGQHIGIVDYMIWP--------------WF--ERFPSM--------------KIN 191
            .|.....|:.||:.:..||..:.|              |.  |.||.:              |..
plant   133 HLKSHDGPFIAGERVSAVDLSLAPKLYHLQVALGHFKSWSVPESFPHVHNYMKTLFSLDSFEKTK 197

  Fly   192 TEQKY 196
            ||:||
plant   198 TEEKY 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 23/64 (36%)
GstA 25..215 CDD:223698 54/199 (27%)
GST_C_Omega 110..235 CDD:198293 27/120 (23%)
DHAR1NP_173387.1 PLN02378 1..213 CDD:166019 54/199 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 63 1.000 Domainoid score I3713
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3083
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.