Sequence 1: | NP_729388.1 | Gene: | GstO2 / 38974 | FlyBaseID: | FBgn0035906 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_173387.1 | Gene: | DHAR1 / 838544 | AraportID: | AT1G19570 | Length: | 213 | Species: | Arabidopsis thaliana |
Alignment Length: | 200 | Identity: | 55/200 - (27%) |
---|---|---|---|
Similarity: | 83/200 - (41%) | Gaps: | 51/200 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 CPFSHRVRLMLAAKHIEHHKIYVDLIEKPEWYKDFSPLGKVPALQLTGVKDQPTLVESLIIAEYL 95
Fly 96 DQQYPQTRLFPTDPLQKALDKILIERFAPVVSAIYPVLTCNPNAPKDAIPNFENA----LDVFEV 156
Fly 157 ELGKRGTPYFAGQHIGIVDYMIWP--------------WF--ERFPSM--------------KIN 191
Fly 192 TEQKY 196 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstO2 | NP_729388.1 | Thioredoxin_like | 5..96 | CDD:294274 | 23/64 (36%) |
GstA | 25..215 | CDD:223698 | 54/199 (27%) | ||
GST_C_Omega | 110..235 | CDD:198293 | 27/120 (23%) | ||
DHAR1 | NP_173387.1 | PLN02378 | 1..213 | CDD:166019 | 54/199 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 1 | 1.000 | 63 | 1.000 | Domainoid score | I3713 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | otm3083 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 1 | 1.000 | - | - | X130 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.910 |