DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and ERD9

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_172508.4 Gene:ERD9 / 837576 AraportID:AT1G10370 Length:227 Species:Arabidopsis thaliana


Alignment Length:236 Identity:58/236 - (24%)
Similarity:92/236 - (38%) Gaps:49/236 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PFSHRVRLMLAAKHIEHHKIYVDLIEKPEWYKDFSPL-GKVPALQLTGVKDQPTLVESLIIAEYL 95
            ||..|.|:.|..|.:.:..:......|.|.....:|: .|:|.|...   |:| :.||.||.||:
plant    15 PFVMRPRIALNLKSVPYEFLQETFGSKSELLLKSNPVHKKIPVLLHA---DKP-VSESNIIVEYI 75

  Fly    96 DQQYPQT--RLFPTDPLQKALDKILIERFAPVVS-----AIYPVLTCNPNAPKDAIPNFENALDV 153
            |..:..:  .:.|:||..:|:.:.    :|..:.     |:...|.......|.|:        :
plant    76 DDTWSSSGPSILPSDPYDRAMARF----WAAYIDEKWFVALRGFLKAGGEEEKKAV--------I 128

  Fly   154 FEVELG-----------KRGTPYFAGQHIGIVD-----YMIW-PWFERFPSMKINTEQKYELDTK 201
            .::|.|           .:|.|:|.|.:||.:|     ::.| ...|...|.||       ||..
plant   129 AQLEEGNAFLEKAFIDCSKGKPFFNGDNIGYLDIALGCFLAWLRVTELAVSYKI-------LDEA 186

  Fly   202 RFEKLLKWRDLMTQDEVVQKTALDVQLHAEFQKSKTLGNPQ 242
            :...|.||.:....|..|:....:....|||.| |....||
plant   187 KTPSLSKWAENFCNDPAVKPVMPETAKLAEFAK-KIFPKPQ 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 20/64 (31%)
GstA 25..215 CDD:223698 49/207 (24%)
GST_C_Omega 110..235 CDD:198293 30/146 (21%)
ERD9NP_172508.4 GST_N_Tau 6..79 CDD:239356 21/67 (31%)
GST_C_Tau 91..221 CDD:198294 32/149 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.