DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and GSTU18

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_172507.1 Gene:GSTU18 / 837575 AraportID:AT1G10360 Length:227 Species:Arabidopsis thaliana


Alignment Length:211 Identity:52/211 - (24%)
Similarity:91/211 - (43%) Gaps:22/211 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RVRLMLAAKHIEHHKIYVDLIEKPEWYKDFSPL-GKVPALQLTGVKDQPTLVESLIIAEYLDQQY 99
            |.|:.|..|.|.:..:......|.|.....:|: .|:|.|...   |:| :.||.||..|:|:.:
plant    19 RARIALHLKSISYEFLQETYGSKSELLLKSNPVHKKMPVLIHA---DKP-VCESNIIVHYIDEAW 79

  Fly   100 PQT--RLFPTDPLQKALDKILIERF-APVVS-----AIYPVLTCNPNAPKD-AIPNFENALDVFE 155
            ..:  .:.|:.|..:|     |.|| |..:.     ::..:||...:..|. ||...|....:.|
plant    80 NSSGPSILPSHPYDRA-----IARFWAAYIDDQWFISVRSILTAQGDEEKKAAIAQVEERTKLLE 139

  Fly   156 VELG--KRGTPYFAGQHIGIVDYMIWPWFERFPSMKINTEQKYELDTKRFEKLLKWRDLMTQDEV 218
            ....  .:|.|:|.|.|||.:|..:..:...:..::::...|: ||..:...|:||.:....|..
plant   140 KAFNDCSQGKPFFNGDHIGYLDIALGSFLGWWRVVELDANHKF-LDETKTPSLVKWAERFCDDPA 203

  Fly   219 VQKTALDVQLHAEFQK 234
            |:....::...|||.:
plant   204 VKPIMPEITKLAEFAR 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 18/60 (30%)
GstA 25..215 CDD:223698 47/190 (25%)
GST_C_Omega 110..235 CDD:198293 31/134 (23%)
GSTU18NP_172507.1 GST_N_Tau 6..79 CDD:239356 19/63 (30%)
GST_C_Tau 91..221 CDD:198294 32/135 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.