DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and GSTU9

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_851249.1 Gene:GSTU9 / 836368 AraportID:AT5G62480 Length:240 Species:Arabidopsis thaliana


Alignment Length:209 Identity:48/209 - (22%)
Similarity:86/209 - (41%) Gaps:36/209 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PFSHRVRLMLAAKHIEHHKIYVDLIEKPEWYKDFSPL-GKVPALQLTGVKDQPTLVESLIIAEYL 95
            |:|.|:.|.|..|.|.:..:..||..|.:....::|: .|:|.|    |.:...:.|||.|.||:
plant    18 PYSKRIELALRLKSIPYQFVQEDLQNKSQTLLRYNPVHKKIPVL----VHNGKPISESLFIIEYI 78

  Fly    96 DQQYPQ-TRLFPTDPLQKALDKILIERF------APVVSAIYPVLTCNPNAPKDAIPNFENALDV 153
            |:.:.. ..:.|.||.:::  |:   ||      ..:...:..|:.......|.|:...:..|.|
plant    79 DETWSNGPHILPEDPYRRS--KV---RFWANYIQLHLYDLVIKVVKSEGEEQKKALTEVKEKLSV 138

  Fly   154 FEVELGKR------GTPYFAGQHIGIVDY----MIWPW--FERFPSMKINTEQKYELDTKRFEKL 206
            .|.|..|.      |.|....:.:.:||.    ::.|:  .|....:||       :|.:....:
plant   139 IEKEGLKEIFSDTDGEPTVTNETMSLVDIVMCTLLSPYKAHEEVLGLKI-------IDPEIVPGV 196

  Fly   207 LKWRDLMTQDEVVQ 220
            ..|.:.:.:..||:
plant   197 YGWINAINETSVVK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 21/64 (33%)
GstA 25..215 CDD:223698 46/202 (23%)
GST_C_Omega 110..235 CDD:198293 23/129 (18%)
GSTU9NP_851249.1 GST_N_Tau 9..82 CDD:239356 22/67 (33%)
GstA 10..183 CDD:223698 42/173 (24%)
GST_C_Tau 93..226 CDD:198294 24/130 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.