DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and GSTL3

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_195899.1 Gene:GSTL3 / 831798 AraportID:AT5G02790 Length:235 Species:Arabidopsis thaliana


Alignment Length:223 Identity:64/223 - (28%)
Similarity:106/223 - (47%) Gaps:21/223 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DGVPRFFSMAFCPFSHRVRLMLAAKHIEH--HKIYVDLIEKPEWYKD-FSPLGKVPALQLTGVKD 81
            ||..|.::...|||:.||.:....|.::.  ..:.:||..:|.|||: ..|..|||||:..|   
plant    26 DGTTRLYTSYVCPFAQRVWITRNFKGLQEKIKLVPLDLGNRPAWYKEKVYPENKVPALEHNG--- 87

  Fly    82 QPTLVESLIIAEYLDQQYPQTRLFPTDPLQKALDKILIERFAPVVSAIYPVLTCNPNAPKDAIP- 145
             ..:.|||.:.:|||..:....|:|.|..::.....|::.....|..:|..|..:|:  |:..| 
plant    88 -KIIGESLDLIKYLDNTFEGPSLYPEDHAKREFGDELLKYTDTFVKTMYVSLKGDPS--KETAPV 149

  Fly   146 --NFENALDVFEVELGKRGTPYFAGQHIGIVDYMIWPWFERFPSMKINTEQKYELDTKRFEKLLK 208
              ..||||..|:      ..|:|.|| :.:||....|:.|||.:: :|...|.::..:| .||..
plant   150 LDYLENALYKFD------DGPFFLGQ-LSLVDIAYIPFIERFQTV-LNELFKCDITAER-PKLSA 205

  Fly   209 WRDLMTQDEVVQKTALDVQLHAEFQKSK 236
            |.:.:.:.:...:|.:|.:...|..|.|
plant   206 WIEEINKSDGYAQTKMDPKEIVEVFKKK 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 26/78 (33%)
GstA 25..215 CDD:223698 56/195 (29%)
GST_C_Omega 110..235 CDD:198293 31/127 (24%)
GSTL3NP_195899.1 GstA 31..210 CDD:223698 56/193 (29%)
GST_N_3 31..108 CDD:290153 25/80 (31%)
GST_C_Lambda 113..231 CDD:198312 32/128 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I2438
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2726
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.730

Return to query results.
Submit another query.