DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and DHAR3

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_568336.1 Gene:DHAR3 / 831532 AraportID:AT5G16710 Length:258 Species:Arabidopsis thaliana


Alignment Length:205 Identity:53/205 - (25%)
Similarity:84/205 - (40%) Gaps:50/205 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GSTKPELPEDGVPRFFSMAF---------------------CPFSHRVRLMLAAKHIEHHKIYVD 54
            |||||    ..|.||.:||.                     |||..:|.|.:..|::.:....||
plant    29 GSTKP----GRVGRFVTMATAASPLEICVKASITTPNKLGDCPFCQKVLLTMEEKNVPYDMKMVD 89

  Fly    55 LIEKPEWYKDFSPLGKVPALQLTGVKDQPTLVESLIIAEYLDQQYPQTRLFPTDPLQKALDKILI 119
            |..||||:...||.||||.::.    |:..:.:|.:|.:.|:::||:..| .|.|.:.::...:.
plant    90 LSNKPEWFLKISPEGKVPVVKF----DEKWVPDSDVITQALEEKYPEPPL-ATPPEKASVGSKIF 149

  Fly   120 ERFAPVVSAIYPVLTCNPNAPKDAIPNFE----NALDVFEVELGKRGTPYFAGQHIGIVDYMIWP 180
            ..|...:.:            ||:....|    :.|..|...:...| |:..|:.|...|..:.|
plant   150 STFVGFLKS------------KDSGDGTEQVLLDELTTFNDYIKDNG-PFINGEKISAADLSLAP 201

  Fly   181 WFERFPSMKI 190
               :...|||
plant   202 ---KLYHMKI 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 32/105 (30%)
GstA 25..215 CDD:223698 46/191 (24%)
GST_C_Omega 110..235 CDD:198293 15/85 (18%)
DHAR3NP_568336.1 PLN02817 3..258 CDD:166458 53/205 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 63 1.000 Domainoid score I3713
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3083
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.