DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and GSTU27

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_189966.1 Gene:GSTU27 / 823491 AraportID:AT3G43800 Length:227 Species:Arabidopsis thaliana


Alignment Length:232 Identity:60/232 - (25%)
Similarity:98/232 - (42%) Gaps:55/232 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FCP--FSHRVRLMLAAKHIEHHKIYVDLI-EKPEWYKDFSPLG-KVPALQLTGVKDQPTLVESLI 90
            |.|  |..||.:.|..|.|:......|:. :|.:.....:|:. |:|.|    :.:...:.||.|
plant    11 FWPSMFGARVIMALEEKEIKFEYKEEDVFGQKTDLLLQSNPVNKKIPVL----IHNGKPVCESNI 71

  Fly    91 IAEYLDQQYPQ---TRLFPTDPLQKALDKI---LIERFAPVVSAIYPVLTCNPNAPKDAIPNFEN 149
            |.||:|:.:..   .||.|:||.||:..:.   ||::  .|..|.....|......::|...|..
plant    72 IVEYIDEVWKDDKTLRLLPSDPYQKSQCRFWADLIDK--KVFDAGRRTWTKRGKEQEEAKQEFIE 134

  Fly   150 ALDVFEVELGKRGTPYFAG-QHIGIVDYMI---WPWFERFP-----SMKINTEQKYELDTKRFEK 205
            .|.|.|.|||.:  .||.| .::.:||.::   :|||..:.     |::.:|           .|
plant   135 ILKVLERELGDK--VYFGGNDNVSMVDLVLISYYPWFHTWETIGGFSVEDHT-----------PK 186

  Fly   206 LLKW-RDLMTQDEVVQKTALDVQLHAEFQKSKTLGNP 241
            |:.| |..:|:..:                ||:|.:|
plant   187 LMDWIRKCLTRPAI----------------SKSLPDP 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 20/69 (29%)
GstA 25..215 CDD:223698 55/204 (27%)
GST_C_Omega 110..235 CDD:198293 30/137 (22%)
GSTU27NP_189966.1 GST_N_Tau 6..80 CDD:239356 21/72 (29%)
GST_C_Tau 93..217 CDD:198294 35/146 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.