DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and GSTU2

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_180509.1 Gene:GSTU2 / 817497 AraportID:AT2G29480 Length:225 Species:Arabidopsis thaliana


Alignment Length:224 Identity:58/224 - (25%)
Similarity:91/224 - (40%) Gaps:46/224 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PFSHRVRLMLAAKHIEHHKIYVDLIEKPEWYKDFSPL-GKVPALQLTGVKDQPTLVESLIIAEYL 95
            |||.||.:.|..|.:.:..:..||.:|.....:.:|: .|||.|    |.:...|.||.:|.||:
plant    17 PFSRRVEMALKLKGVPYEYLEEDLPKKSTLLLELNPVHKKVPVL----VHNDKLLSESHVILEYI 77

  Fly    96 DQQYPQTRLFPTDPLQKAL---------DKILIERFAPVVSAIYPVLTCNPNAPKDAIPNFENAL 151
            ||.:....:.|.||.:||:         ::||...|.|:|.|        ......||......|
plant    78 DQTWNNNPILPHDPYEKAMVRFWAKFVDEQILPVGFMPLVKA--------EKGIDVAIEEIREML 134

  Fly   152 DVFEVELGKRGTPYFAGQHIGIVDYM-----------IWPWFERFPSMKINTEQKYELDTKRFEK 205
            ...|.|:  .|..:|.|:.||.:|.:           .|...    .:.:..|     ||  |.:
plant   135 MFLEKEV--TGKDFFGGKTIGFLDMVAGSMIPFCLARAWECL----GIDMTPE-----DT--FPE 186

  Fly   206 LLKWRDLMTQDEVVQKTALDVQLHAEFQK 234
            |.:|...:.:.|:|::.....:.|.|..|
plant   187 LNRWIKNLNEVEIVRECIPPKEKHIERMK 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 22/64 (34%)
GstA 25..215 CDD:223698 53/203 (26%)
GST_C_Omega 110..235 CDD:198293 31/145 (21%)
GSTU2NP_180509.1 GST_N_Tau 8..81 CDD:239356 24/67 (36%)
GstA 9..196 CDD:223698 53/203 (26%)
GST_C_Tau 91..217 CDD:198294 32/146 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.