DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and GSTU4

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_180507.1 Gene:GSTU4 / 817495 AraportID:AT2G29460 Length:224 Species:Arabidopsis thaliana


Alignment Length:207 Identity:51/207 - (24%)
Similarity:87/207 - (42%) Gaps:38/207 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PFSHRVRLMLAAKHIEHHKIYVDLIEKPEWYKDFSPL-GKVPALQLTGVKDQPTLVESLIIAEYL 95
            ||:.||.:....|.:.:..:..|::.|.......:|: .|||.|...|    ..|.||.:|.||:
plant    17 PFTRRVEMAFKLKGVPYEYLEQDIVNKSPLLLQINPVYKKVPVLVYKG----KILSESHVILEYI 77

  Fly    96 DQQYPQTRLFPTDPLQKAL----DKILIERFAPVVSAIYPVLTCNPNAPKDAIPNFENALDVFE- 155
            ||.:....:.|.||.:||:    .|.:.|:..||  |...|    ..|.|......:.|.::|. 
plant    78 DQIWKNNPILPQDPYEKAMALFWAKFVDEQVGPV--AFMSV----AKAEKGVEVAIKEAQELFMF 136

  Fly   156 VELGKRGTPYFAGQHIGIVDYMI-----------WPWFERFPSMKINTEQKYELDTKRFEKLLKW 209
            :|....|..:|.|:.||.:|.:.           |      ..|.|:.     :..::|.:|.:|
plant   137 LEKEVTGKDFFGGKTIGFLDLVAGSMIPFCLARGW------EGMGIDM-----IPEEKFPELNRW 190

  Fly   210 RDLMTQDEVVQK 221
            ...:.:.|:|::
plant   191 IKNLKEIEIVRE 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 19/64 (30%)
GstA 25..215 CDD:223698 49/199 (25%)
GST_C_Omega 110..235 CDD:198293 27/128 (21%)
GSTU4NP_180507.1 GST_N_Tau 8..81 CDD:239356 21/67 (31%)
GstA 9..197 CDD:223698 49/200 (25%)
GST_C_Tau 91..216 CDD:198294 28/129 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.