DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and GSTU6

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_180505.1 Gene:GSTU6 / 817493 AraportID:AT2G29440 Length:223 Species:Arabidopsis thaliana


Alignment Length:198 Identity:52/198 - (26%)
Similarity:89/198 - (44%) Gaps:24/198 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PFSHRVRLMLAAKHIEHHKIYVDLIEKPEWYKDFSPL-GKVPALQLTGVKDQPTLVESLIIAEYL 95
            |||.|:.:.|..|.:.:..:..||..|.......||: .|:|.|    |.:..|::||.:|.||:
plant    16 PFSRRIEMALKLKGVPYEYLEEDLENKSSLLLALSPIHKKIPVL----VHNGKTIIESHVILEYI 76

  Fly    96 DQQYPQTRLFPTDPLQKA----LDKILIERFAPVVSAIYPVLTCNPNAPKDAIPNFENALDVFEV 156
            |:.:....:.|.||.|::    |.|::.|:   :|:..:..|.......:..|......:...|.
plant    77 DETWKHNPILPQDPFQRSKARVLAKLVDEK---IVNVGFASLAKTEKGREVLIEQTRELIMCLEK 138

  Fly   157 ELGKRGTPYFAGQHIGIVDY----MIWPWFER-FPSMKINTEQKYELDTKRFEKLLKWRDLMTQD 216
            ||.  |..||.|:.:|.:|:    ||....|| :..|.:..     :..|:|.:..||...:.:.
plant   139 ELA--GKDYFGGKTVGFLDFVAGSMIPFCLERAWEGMGVEM-----ITEKKFPEYNKWVKKLKEV 196

  Fly   217 EVV 219
            |:|
plant   197 EIV 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 21/64 (33%)
GstA 25..215 CDD:223698 50/192 (26%)
GST_C_Omega 110..235 CDD:198293 27/119 (23%)
GSTU6NP_180505.1 GST_N_Tau 7..80 CDD:239356 22/67 (33%)
GST_C_Tau 90..214 CDD:198294 28/120 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2726
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.720

Return to query results.
Submit another query.