DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and GstD10

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster


Alignment Length:160 Identity:38/160 - (23%)
Similarity:58/160 - (36%) Gaps:27/160 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 PEWYKDFSPLGKVPALQLTGVKDQPTLVESLIIAEYLDQQY-PQTRLFPTDPLQKALDK------ 116
            ||:.| .:|...:|.|...|.    .|.||..|..||.::| ...:|||.|..::||..      
  Fly    42 PEYLK-INPQHTIPTLHDHGF----ALWESRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFD 101

  Fly   117 --ILIERFAPVVSAIYPVLTCNPNAPKDAIPNFENALDVFEVELGKRGTPYFAGQHIGIVDYMIW 179
              .|.:.|:   ...||.:.....|.::.....|.|.:.....|  .|..|.||....:.|... 
  Fly   102 MGTLYKSFS---EYYYPQIFLKKPANEENYKKIEVAFEFLNTFL--EGQTYSAGGDYSLADIAF- 160

  Fly   180 PWFERFPSMKINTEQKYELDTKRFEKLLKW 209
                   ...::|......|.||:..:.:|
  Fly   161 -------LATVSTFDVAGFDFKRYANVARW 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 12/36 (33%)
GstA 25..215 CDD:223698 38/160 (24%)
GST_C_Omega 110..235 CDD:198293 20/108 (19%)
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 13/37 (35%)
PLN02473 3..196 CDD:166114 38/160 (24%)
GST_C_Delta_Epsilon 89..205 CDD:198287 20/108 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460153
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.