DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and Gstt3

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_038954940.1 Gene:Gstt3 / 499422 RGDID:1562732 Length:298 Species:Rattus norvegicus


Alignment Length:233 Identity:54/233 - (23%)
Similarity:89/233 - (38%) Gaps:53/233 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PFSHRVRLMLAAKHIEHHKIYVDLIEKPEWYKDFSPLGKVPALQLTGVKDQP-TLVESLIIAEYL 95
            ||..|...:|..:|      |.|.      :...:||.|||||     ||.. .|.||:.|..||
  Rat    84 PFQLRTIELLKGQH------YTDA------FAQVNPLRKVPAL-----KDGDFVLAESVAILLYL 131

  Fly    96 DQQY-PQTRLFPTDPLQKA-LDKILIERFAPVVSA---------IYPVLTCNPNAPK---DAIPN 146
            .::| .....:|.|...:| :|:.|..:...:.|.         ::||....|..|:   ..:..
  Rat   132 SRKYKAPDHWYPQDLQTRARVDEYLAWQHTALRSCCSRAMWQKMMFPVFLGQPVPPERLASTLAE 196

  Fly   147 FENALDVFEVELGKRGTPYFAGQHIGIVDY-----MIWP------WFERFPSM-----KINTEQK 195
            .:..|.:.|.:. .:...:..|.||.:.|.     ::.|      .||..|.:     ::.....
  Rat   197 LDGCLQMLEDKF-LQNKAFLTGPHISVADLVAITELMHPVSAGCKIFESRPKLAAWRQRVEAAVG 260

  Fly   196 YELDTKRFEKLLKWRDL--MTQDEVVQKTALDVQ--LH 229
            ..|..:..|.:||.:|:  :....:.:|..|.||  ||
  Rat   261 ESLFQEAHEVVLKAKDMPPLMDPTLKEKLKLSVQCLLH 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 21/64 (33%)
GstA 25..215 CDD:223698 48/215 (22%)
GST_C_Omega 110..235 CDD:198293 29/153 (19%)
Gstt3XP_038954940.1 GST_N_Theta 60..135 CDD:239348 22/67 (33%)
GST_C_Theta 149..273 CDD:198292 20/124 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348100
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.