DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and GstD7

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster


Alignment Length:198 Identity:45/198 - (22%)
Similarity:84/198 - (42%) Gaps:34/198 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 FSMAFCPFSHRVRLMLAAKHIEHHKIYVDLIE----KPEWYKDFSPLGKVPALQLTGVKDQPTLV 86
            |.||  |.|..::::..|..:|.:...::.:|    |||:.: .:|...:|.|...|.    .:.
  Fly     9 FPMA--PASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVR-INPQHTIPTLVDNGF----VIW 66

  Fly    87 ESLIIAEYLDQQY--PQTRLFPTDPLQKALDKILIERFAPVVSAIYPVLT--------CNPNAPK 141
            ||..||.||.::|  |.:.|:|.||.::||   :.:|....:..:|..||        ......:
  Fly    67 ESRAIAVYLVEKYGKPDSPLYPNDPQKRAL---INQRLYFDMGTLYDALTKYFFLIFRTGKFGDQ 128

  Fly   142 DAIPNFENALDVFEVELGKRGTPYFAGQHIGIVDYMIWPWFERFPSMKINTEQKYELDTKRFEKL 206
            :|:....:|.......|  .|..:.||..:.:.|.:|        ...::|.:.:..|..:|..:
  Fly   129 EALDKVNSAFGFLNTFL--EGQDFVAGSQLTVADIVI--------LATVSTVEWFSFDLSKFPNV 183

  Fly   207 LKW 209
            .:|
  Fly   184 ERW 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 20/73 (27%)
GstA 25..215 CDD:223698 45/198 (23%)
GST_C_Omega 110..235 CDD:198293 18/108 (17%)
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 21/74 (28%)
GstA 6..188 CDD:223698 45/198 (23%)
GST_C_Delta_Epsilon 92..206 CDD:198287 18/108 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460157
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.