Sequence 1: | NP_729388.1 | Gene: | GstO2 / 38974 | FlyBaseID: | FBgn0035906 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_524915.1 | Gene: | GstD6 / 48339 | FlyBaseID: | FBgn0010042 | Length: | 215 | Species: | Drosophila melanogaster |
Alignment Length: | 203 | Identity: | 48/203 - (23%) |
---|---|---|---|
Similarity: | 85/203 - (41%) | Gaps: | 43/203 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 FSMAFCPFSHRVRLMLAAKHIEHHKIYVDLI--EKPE-WYKDFSPLGKVPALQLTGVKDQPTLVE 87
Fly 88 SLIIAEYLDQQY-PQTRLFPTDPLQKAL--DKILIER---FAPVVSAIYPVL-TCNP-------- 137
Fly 138 -NAPKDAIPNFENALDVFEVELGKRGTPYFAGQHIGIVDYMIWPWFERFPSMKINTEQKYELDTK 201
Fly 202 RFEKLLKW 209 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstO2 | NP_729388.1 | Thioredoxin_like | 5..96 | CDD:294274 | 17/72 (24%) |
GstA | 25..215 | CDD:223698 | 48/203 (24%) | ||
GST_C_Omega | 110..235 | CDD:198293 | 24/115 (21%) | ||
GstD6 | NP_524915.1 | GST_N_Delta_Epsilon | 1..74 | CDD:239343 | 18/73 (25%) |
PLN02395 | 11..208 | CDD:166036 | 46/196 (23%) | ||
GST_C_Delta_Epsilon | 88..204 | CDD:198287 | 24/115 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45460156 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |