DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and GstD4

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster


Alignment Length:189 Identity:44/189 - (23%)
Similarity:75/189 - (39%) Gaps:31/189 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SHRVRLMLAAKHIEHHKIYVDLIE----KPEWYKDFSPLGKVPALQLTGVKDQPTLVESLIIAEY 94
            |..:.::..|..:|.:|..:.:.|    |||:.| .:|...:|.|...|.    .:.||..||.|
  Fly    12 SRTIIMVAKALGLELNKKQLRITEGEHLKPEFLK-LNPQHTIPTLVDNGF----AIWESRAIAVY 71

  Fly    95 LDQQY-PQTRLFPTDPLQKALDK--------ILIERFAPVVSAIYPVLTCNPNAPKDAIPNFENA 150
            |.::| ....|||.||.::||..        .|.:.|   :...||.:........:.....|.|
  Fly    72 LVEKYGKDDSLFPNDPQKRALINQRLYFDMGTLHDSF---MKYYYPFIRTGQLGNAENYKKVEAA 133

  Fly   151 LDVFEVELGKRGTPYFAGQHIGIVDYMIWPWFERFPSMKINTEQKYELDTKRFEKLLKW 209
            .:..::.|  .|..|.||..:.:.|..|        ...::|.:..|.|..::..:.:|
  Fly   134 FEFLDIFL--EGQDYVAGSQLTVADIAI--------LSSVSTFEVVEFDISKYPNVARW 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 18/65 (28%)
GstA 25..215 CDD:223698 44/189 (23%)
GST_C_Omega 110..235 CDD:198293 19/108 (18%)
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 44/189 (23%)
GST_N_Delta_Epsilon 1..74 CDD:239343 19/66 (29%)
GST_C_Delta_Epsilon 88..204 CDD:198287 19/108 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460155
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.