DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and eEF1gamma

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster


Alignment Length:173 Identity:42/173 - (24%)
Similarity:62/173 - (35%) Gaps:33/173 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 WYKDFSPLGKVPALQLTGVKDQPTLVESLII-----AEY-------LDQQYPQTRLFPTDPLQKA 113
            |:.......:|.|:    |||.....::|:.     ||:       ..||..|.:.....|.:|.
  Fly   186 WFVTILNQKQVQAV----VKDYKLCEKALVFDPKKYAEFQAKTGAAKPQQQAQQQKQEKKPKEKK 246

  Fly   114 LDKILIERFAPVVSAIYPVLTCNPNA--PKDAIP----NFENALDVFEVELGKRGTPYFAGQHIG 172
            .........|..:.|....|...|.:  |.||:|    ||::...|:..|...:..|||..: ..
  Fly   247 EAPKKAAEPAEELDAADEALAAEPKSKDPFDALPKGTFNFDDFKRVYSNEDEAKSIPYFFDK-FD 310

  Fly   173 IVDYMIWPWFERFPSMKINTE-----QKYELDTKRFEKLLKWR 210
            ..:|.||     |...|.|.|     ....|.|..|::|.|.|
  Fly   311 AENYSIW-----FGEYKYNEELSKVFMSCNLITGMFQRLDKMR 348

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 9/46 (20%)
GstA 25..215 CDD:223698 42/173 (24%)
GST_C_Omega 110..235 CDD:198293 29/112 (26%)
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342